gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
Works with
AI-first code editor with Composer
Before installing skills in Cursor, ensure your development environment meets these requirements:
node --versionggetExecute the skills CLI command in your project's root directory to begin installation:
Fetches gget from davila7/claude-code-templates and configures it for Cursor.
The CLI shows a list of agents. Use arrow keys and space to select Cursor:
Confirm successful installation by checking the skill directory location:
Restart Cursor to activate gget. Access via /gget in your agent's command palette.
We perform automated surface-level scans (Gen AI Scanner, Socket, Snyk) during installation. These checks detect common vulnerabilities but do not guarantee complete security. Always review skill source code and verify the publisher's reputation before production use.
Skills execute code in your environment. Always review source, verify the publisher, and test in isolation before production.
Submit your Claude Code skill and start earning
Create detailed user stories, acceptance criteria, and feature specs
Example
Generate user stories for 'password reset feature' with acceptance criteria, edge cases, and test scenarios
Reduce spec writing time by 50%, ensure comprehensive coverage
Research competitors, compare features, identify gaps
Example
Analyze 5 competitor products, create feature comparison matrix, suggest differentiation opportunities
Complete competitive research in 2 hours instead of 2 days
Evaluate features using frameworks (RICE, ICE, Kano) and create prioritized backlogs
Example
Score 20 feature ideas using RICE framework, generate prioritized roadmap with rationale
0
total installs
0
this week
24.2K
GitHub stars
0
upvotes
Run in your terminal
0
installs
0
this week
24.2K
stars
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
Install gget in a clean virtual environment to avoid conflicts:
# Using uv (recommended)
uv uv pip install gget
# Or using pip
uv pip install --upgrade gget
# In Python/Jupyter
import gget
Basic usage pattern for all modules:
# Command-line
gget <module> [arguments] [options]
# Python
gget.module(arguments, options)
Most modules return:
-csv flagCommon flags across modules:
-o/--out: Save results to file-q/--quiet: Suppress progress information-csv: Return CSV format (command-line only)Retrieve download links and metadata for Ensembl reference genomes.
Parameters:
species: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'-w/--which: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all-r/--release: Ensembl release number (default: latest)-l/--list_species: List available vertebrate species-liv/--list_iv_species: List available invertebrate species-ftp: Return only FTP links-d/--download: Download files (requires curl)Examples:
# List available species
gget ref --list_species
# Get all reference files for human
gget ref homo_sapiens
# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)
Locate genes by name or description across species.
Parameters:
searchwords: One or more search terms (case-insensitive)-s/--species: Target species (e.g., 'homo_sapiens', 'mouse')-r/--release: Ensembl release number-t/--id_type: Return 'gene' (default) or 'transcript'-ao/--andor: 'or' (default) finds ANY searchword; 'and' requires ALL-l/--limit: Maximum results to returnReturns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
Examples:
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric
# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
Parameters:
ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs-n/--ncbi: Disable NCBI data retrieval-u/--uniprot: Disable UniProt data retrieval-pdb: Include PDB identifiers (increases runtime)Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
Examples:
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
# Include PDB IDs
gget info ENSG00000034713 -pdb
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
Fetch nucleotide or amino acid sequences for genes and transcripts.
Parameters:
ens_ids: One or more Ensembl identifiers-t/--translate: Fetch amino acid sequences instead of nucleotide-iso/--isoforms: Return all transcript variants (gene IDs only)Returns: FASTA format sequences
Examples:
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853
# Get all protein isoforms
gget seq -t -iso ENSG00000034713
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
BLAST nucleotide or amino acid sequences against standard databases.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)-db/--database:
-l/--limit: Max hits (default: 50)-e/--expect: E-value cutoff (default: 10.0)-lcf/--low_comp_filt: Enable low complexity filtering-mbo/--megablast_off: Disable MegaBLAST (blastn only)Examples:
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)
Locate genomic positions of sequences using UCSC BLAT.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-st/--seqtype: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)-a/--assembly: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage
Examples:
# Find genomic location in human
gget blat ATCGATCGATCGATCG
# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")
Align multiple nucleotide or amino acid sequences using Muscle5.
Parameters:
fasta: Sequences or path to FASTA/.txt file-s5/--super5: Use Super5 algorithm for faster processing (large datasets)Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)
Examples:
# Align sequences from file
gget muscle sequences.fasta -o aligned.afa
# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
# Python
gget.muscle("sequences.fasta", save=True)
Perform fast local protein or translated DNA alignment using DIAMOND.
Parameters:
--reference: Reference sequences (string/list) or FASTA file path (required)--sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive--threads: CPU threads (default: 1)--diamond_db: Save database for reuse--translated: Enable nucleotide-to-amino acid alignmentReturns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
Examples:
# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4
# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
Query RCSB Protein Data Bank for structure and metadata.
Parameters:
pdb_id: PDB identifier (e.g., '7S7U')-r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)-i/--identifier: Assembly, entity, or chain IDReturns: PDB format (structures) or JSON (metadata)
Examples:
# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb
# Get metadata
gget pdb 7S7U -r entry
# Python
gget.pdb("7S7U", save=True)
Predict 3D protein structures using simplified AlphaFold2.
Setup Required:
# Install OpenMM first
uv pip install openmm
# Then setup AlphaFold
gget setup alphafold
Parameters:
sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling-mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)-mfm/--multimer_for_monomer: Apply multimer model to single proteins-r/--relax: AMBER relaxation for top-ranked modelplot: Python-only; generate interactive 3D visualization (default: True)show_sidechains: Python-only; include side chains (default: True)Returns: PDB structure file, JSON alignment error data, optional 3D visualization
Examples:
# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r
# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)
# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
Predict Eukaryotic Linear Motifs in protein sequences.
Setup Required:
gget setup elm
Parameters:
sequence: Amino acid sequence or UniProt Acc-u/--uniprot: Indicates sequence is UniProt Acc-e/--expand: Include protein names, organisms, references-s/--sensitivity: DIAMOND alignment sensitivity (default: "very-sensitive")-t/--threads: Number of threads (default: 1)Returns: Two outputs:
Examples:
# Predict motifs from sequence
Make data-driven prioritization decisions faster
Draft PRDs, status updates, and stakeholder presentations
Example
Create executive summary of Q3 roadmap, monthly progress report, feature launch announcement
Save 3-5 hours/week on communication overhead
Prerequisites
Time Estimate
30-60 minutes to see productivity improvements
Steps
Common Pitfalls
✓ Do
✗ Don't
💡 Pro Tips
✓ Use when
Use for user story writing, competitive research, roadmap prioritization, stakeholder communication, and PRD drafting. Best for reducing repetitive documentation and research work.
✗ Avoid when
Avoid for strategic product vision (requires deep customer empathy), pricing decisions (needs market and financial expertise), or when face-to-face customer discovery is more valuable than speed.
davila7/claude-code-templates
mattpocock/skills
parcadei/continuous-claude-v3
cursor/plugins
ailabs-393/ai-labs-claude-skills
pproenca/dot-skills
Registry listing for gget matched our evaluation — installs cleanly and behaves as described in the markdown.
gget reduced setup friction for our internal harness; good balance of opinion and flexibility.
gget fits our agent workflows well — practical, well scoped, and easy to wire into existing repos.
I recommend gget for anyone iterating fast on agent tooling; clear intent and a small, reviewable surface area.
gget is among the better-maintained entries we tried; worth keeping pinned for repeat workflows.
Useful defaults in gget — fewer surprises than typical one-off scripts, and it plays nicely with `npx skills` flows.
I recommend gget for anyone iterating fast on agent tooling; clear intent and a small, reviewable surface area.
Useful defaults in gget — fewer surprises than typical one-off scripts, and it plays nicely with `npx skills` flows.
Keeps context tight: gget is the kind of skill you can hand to a new teammate without a long onboarding doc.
Useful defaults in gget — fewer surprises than typical one-off scripts, and it plays nicely with `npx skills` flows.
showing 1-10 of 40